PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c11_10350V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 331aa    MW: 36879.2 Da    PI: 5.4029
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c11_10350V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.4e-151865148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd +l   v+  G g+W+  +++ g++R++k+c++rw +yl
  Pp3c11_10350V3.2.p 18 KGPWTAEEDSILTAFVRANGEGNWRILPKRAGLKRCRKSCRLRWMNYL 65
                        79********************************************97 PP

2Myb_DNA-binding54.72.3e-1771114146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++Edel+++++ +lG++ W++Ia +++ gRt++++k++w++
  Pp3c11_10350V3.2.p  71 RGNFSPDEDELIIKLHSLLGNK-WSLIAGRIP-GRTDNEIKNYWNS 114
                         89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3611365IPR017930Myb domain
SuperFamilySSF466891.57E-2916112IPR009057Homeodomain-like
SMARTSM007175.1E-131767IPR001005SANT/Myb domain
PfamPF002491.8E-131865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-221972IPR009057Homeodomain-like
CDDcd001674.25E-102065No hitNo description
PROSITE profilePS5129426.79966120IPR017930Myb domain
SMARTSM007173.6E-1670118IPR001005SANT/Myb domain
PfamPF002498.4E-1671114IPR001005SANT/Myb domain
CDDcd001675.22E-1273116No hitNo description
Gene3DG3DSA:1.10.10.606.3E-2773120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRAPSSSRV TTGEGLNKGP WTAEEDSILT AFVRANGEGN WRILPKRAGL KRCRKSCRLR  60
WMNYLRPDLK RGNFSPDEDE LIIKLHSLLG NKWSLIAGRI PGRTDNEIKN YWNSRLKRNL  120
QDMEGNQRQQ LVATPLSVSL LDSSTEIKVE DFPCSNQLGM SGPPSPIDEK PPMEALLGTH  180
HHSNDLDPSI ITKPQLLNST DFHAMPRGES TLSEPTSSDG TCFEESCDHQ SLEGYSSSCN  240
WAPFDNTQKP LSFTQASSPE SVLLFQQYFP SQPQDDFLCS DFGLTDFTST NYIPEFTSLQ  300
NLLQCGPFSP IHKNLPATWI GNYSGDGFQT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26161205108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9S9K92e-57MYB3_ARATH; Transcription factor MYB3
STRINGPP1S61_196V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-58myb domain protein 3